Sortering: Namn Artikelnummer Publicerad Artiklar/sida: Visar 226 - 250 av 420

Mer bioenergi - vad innebär det?

En studie av olika markanvändningsintressen

För att klara klimatmål och mål om ökad andel förnybara bränslen så kan bioenergi väntas få en allt större betydelse i energisystemet framöver. Men bioenergi kräver mark, och konkurrerar då med andra intressen, exempelvis livsmedels- och skogsproduktion, om den tillgängliga arealen. Utökade markanspråk för bioenergi kan därmed komma att orsaka intressekonflikter.

På uppdrag av Energimyndigheten har planeringsbyrån Radar AB undersökt frågan om vilka potentiella konflikter som kan uppstå och vilka styrmedel som kan användas för att undvika konflikter. Finansiering av uppdraget har kommit från Miljömålsrådet via åtgärdsstrategin för hushållning med mark, vatten och byggnader (HUM).

Format: A4
Identifierare ER2007:44
Utgivningsår 2007
Lagersaldo: 45
Pris: 150,00 kr
Artikel nr 1975
Ladda ner

Metod för att beräkna Sveriges energiavtryck

Indikatorer för energianvändning såsom miljöpåverkan kan beskrivas utifrån två olika perspektiv: ett produktionsperspektiv och ett konsumtionsperspektiv. Denna rapport beskriver olika metoder för att beräkna energiavtryck, ta fram en metod på en ny indikator av energiavtryck samt belysa generationsmålet utifrån denna beräkning.

Format: .
Identifierare ER2016:04
Utgivningsår 2016
Lagersaldo: 48
Pris: 150,00 kr
Artikel nr 2730
Ladda ner

Metoder för att utvärdera styrmedel för effektivare energianvändning

Rapporten syftar till att redovisa kunskapsläget om metoder för utvärdering av energieffektiviseringsstyrmedel. Mål för energieffektivisering identifieras, och därefter beskrivs kända metoder för att utvärdera mot målen. Rapporten redovisar också metodproblem som är relaterade till utvärdering av styrmedlen för energieffektivisering. Utvärderingsmetoder för olika styrmedel föreslås, enligt en modell som utvecklats inom IEA.

Format: A4
Identifierare ER2006:24
Utgivningsår 2006
Lagersaldo: 20
Pris: 150,00 kr
Artikel nr 1821
Ladda ner

Metoder för utvärdering av styrmedel

En metautvärdering grundad på litteratur och två fall

Syftet med rapporten är att ge underlag för en mall för hur utvärderingar av styrmedel ska göras på Energimyndigheten. Texten bygger på den aktuella akademiska litteraturen kring utvärderingar, två fall av styrmedel (PFE och SIO) som går in i detalj på externa utvärderingars metoder respektive förberedelser för utvärdering, samt metoder använda i andra studier. Resultatet är en mall för utvärdering i fem steg. I denna betonas vikten av att förbereda utvärderingen genom att organisera datainsamling löpande, vikten av kvalitativ granskning av hur styrmedlet är utformat och dess effektlogik, samt den energipolitiska återkopplingen som mål för utvärderingen. Speciellt utrymme ägnas åt effektanalys- och effektivitetsmetoder, inklusive icke-traditionella metoder för samhällsekonomisk analys. Även ”följeforskning” och andra metoder berörs.

Format: A4
Identifierare ER2015:06
Utgivningsår 2015
Lagersaldo: 16
Pris: 150,00 kr
Artikel nr 2660
Ladda ner

Miljöeffekter (klimat, miljö, hälsa) av alternativa drivmedel

Denna rapport är en del av arbetet med jämförelseprojektet som har tillkommit som en fortsättning på samverkansprojektet ""Miljöanpassat transportsystem"" (MaTs). Jämförelseprojektet syftade till att skapa en modell för att jämföra miljöpåverkan mellan olika transportkoncept. Slutrapport utkom i Naturvårdsverkets rapportserie under hösten 2001 (NV Rapport 5143).

I denna rapport görs en granskning av miljöeffekterna av olika alternativa drivmedel ställt i relation till de miljömål som satts upp i Sverige och EU. En genomgång av ett tjugotal miljöhot för att identifiera i vilken utsträckning transporter och alternativa drivmedel utgör ett hot. Därefter har de aktuella miljöeffekterna från alternativa drivmedel granskats och - så långt det är möjligt, kvantifierats. De studerade alternativa drivmedlen är gasol/LPG, naturgas, biogas, RME, etanol, metanol, DME samt n-paraffiner via Fischer-Tropsch-syntes.

Format: A4
Identifierare ER 21:2001
Utgivningsår 2002
Lagersaldo: 29
Pris: 150,00 kr
Artikel nr 1446
Ladda ner

Miljöeffekter vid primärproduktion av biobränslen

I denna rapport sammanställs kunskapsläget rörande miljöeffekter av primär biobränsleproduktion i Sverige. Utifrån antagandet att referensgrödan är en plöjd åker diskuteras de grödor som kan komma att odlas på jordbruksmark.

För skogsmarken analyseras GROT, stubbrytning och intensiv-odlad gran. De miljöeffekter som behandlas är kollagringen i marken, kompaktering (med medföljande erosionsproblem), näringsläckage, bekämpningsmedel, landskapsdiversitet, och biodiversitet. Diversiteten diskuteras i ett lokalt och regionalt perspektiv, men för de övriga handlar det om de lokala effekterna.

Format: A4
Identifierare ER2009:12
Utgivningsår 2009
Lagersaldo: 29
Pris: 150,00 kr
Artikel nr 2089
Ladda ner

Miljökonsekvenser av stubbskörd

Allt mer biobränsle efterfrågas som ersättning för fossila bränslen. Skogsindustrin behöver mer råvara. Samtidigt minskar skogsmarksarealen bland annat pga ökade avsättningar för naturvård. Nya sätt att producera skogsbränslen kommer därför sannolikt att behövas. Stubbar utgör en betydande och än så länge outnyttjad bränsleresurs. Miljökon­sekvenserna av stubbskörd är emellertid betydligt mindre kända jämfört med GROT. För att nya skogsskötselmetoder som stubbskörd ska kunna tas i bruk behöver Skogsstyrelsen underlag för rekommendationer i form av en miljöanalys av den nya brukningsmetoden. Denna rapport är en kunskapssammanställning om miljöeffekter av stubbskörd, och ett steg på vägen mot en miljöanalys.

Format: A4
Identifierare ER2007:40
Utgivningsår 2007
Lagersaldo: 23
Pris: 150,00 kr
Artikel nr 1961
Ladda ner

Miljömålsrapport 2002

Energisektorn har en stor påverkan på miljön och ett omfattande miljöarbete bedrivs sedan lång tid tillbaka på Energimyndigheten. Det går att göra kopplingar mellan Energimyndighetens arbete och alla 15 miljömål. Rapporten visar på exempel från den verksamhet som bidrar till att nå en bit på vägen mot miljömålen Begränsad klimatpåverkan, Frisk luft, Bara natrulig försurning och God bebyggd miljö.

Den forskning, utveckling och demonstration som Energimyndigheten finansierar bidrar till att nå flera miljömål, likaså bidrar information, provning, märkning, teknikupphandling och kommunal energirådgivning. Till sist ska nämnas att ekonomiska stöd och bidrag lett till minskade koldioxidutsläpp och därigenom har ett steg närmare Begränsad klimatpåverkan tagits.

Format: A4
Identifierare ER 7:2003
Utgivningsår 2003
Lagersaldo: 69
Pris: 150,00 kr
Artikel nr 1526
Ladda ner

Myndighetens arbete med energieffektivisering

Sammanställning och analys 2012

Energimyndigheten samordnar arbetet med energieffektiva åtgärder för myndigheter enligt förordning (2009:893). Myndigheter som berörs av förordningen ska välja minst två energieffektiviserande åtgärder att arbeta med och årligen redovisa resultatet av detta arbete. Denna rapport beskriver myndigheternas rapportering i februari 2012, samt resultatet från en djupanalys av 20 myndigheters energiarbete. Rapporten är framtagen av KanEnergi Sweden AB på uppdrag av Energimyndigheten.

Format: A4
Identifierare ER2012:31
Utgivningsår 2013
Lagersaldo: 71
Pris: 150,00 kr
Artikel nr 2469
Ladda ner

Myndigheters arbete med energieffektivisering

Sammanställning och analys av rapporteringsåret 2013

Energimyndigheten har ett samordningsansvar för arbetet med energieffektiva åtgärder inom den offentliga sektorn i Sverige. Denna rapport handlar om myndigheters arbete med energieffektivisering i enlighet med Förordning (2009:893) om energieffektiva åtgärder i myndigheter.
Den här rapporten visar resultatet från myndigheternas rapportering i februari 2013 och avser därmed 2012 års energianvändning. Jämförelser görs även med rapporteringarna år 2010 och år 2011. Dessutom har en djupare analys gjorts på 32 av myndigheternas rapporteringar. Syftet med rapporten är att belysa om statliga myndigheter kan ses som föregångare i energieffektivisering och om myndigheterna följer kraven i förordningen samt Energimyndighetens riktlinjer.

Format: A4
Identifierare ER2013:19
Utgivningsår 2013
Lagersaldo: 22
Pris: 150,00 kr
Artikel nr 2589
Ladda ner

Myndigheters arbete med energieffektivisering

Sammanställning och analys av arbetet utifrån Förordning (2009:893) om energieffektiva åtgärder för myndigheter under perioden 2010-2014

Energimyndigheten har sedan 2010 samordnat arbetet med energieffektiva åtgärder inom den offentliga sektorn i Sverige, i enlighet med Förordning (2009:893) om energieffektiva åtgärder i myndigheter. Denna rapport syftar till
- att sammanfatta arbetet och erfarenheterna från arbetet med Energieffektiva myndigheter under åren 2010-2014,
- redovisa hur Energimyndigheten har arbetat för att informera och vägleda statliga myndigheter i deras arbete för ökad energieffektivitet samt
- ta fram konkreta rekommendationer för det fortsatta energieffektiviseringsarbetet riktat mot myndigheterna, enligt det nya direktivet.

Format: A4
Identifierare ER2014:26
Utgivningsår 2014
Lagersaldo: 26
Pris: 150,00 kr
Artikel nr 2659
Ladda ner

Månadsvis avläsning av elmätare

Slutredovisning av regeringsuppdrag 2002-05-27

Rapporten utgör den slutredovisning som lämnades till regeringen den 30 maj 2002. Uppdraget handlar om huruvida mätperiodens längd bör ändras och om systemet med preliminärdebitering av elförbrukning bör avskaffas.

I rapporten föreslår Energimyndigheten att elnätföretagen ska vara skyldiga att läsa av elmätarna för samtliga sina kunder minst en gång i månaden. Det nya kraven är tänkta att införas etappvis. Energimyndigheten föreslår även att kraven för timvis mätning skärps för större elanvändare, krav på automatisk avbrottsregistrering införs och att statistik över elförbrukningen ska rapporteras till elanvändaren.

Format: A4
Identifierare ER 12:2002
Utgivningsår 2002
Lagersaldo: 71
Pris: 150,00 kr
Artikel nr 1472
Ladda ner

Mätning av kall- och varmvatten i tio hushåll

Energimyndigheten har mätt vattenanvändningen i tio hushåll, fyra lägenheter och sex villor, samt i varmvattencentraler och gemensamma tvättstugor i två flerbostadshus under tiden oktober 2006 till augusti 2007. Resultatet av mätningarna presenteras i denna rapport. Rapporten ska öka kunskapen om hur tappvatten används i svenska hushåll. Det övergripande syftet är att få kunskap om hur vi ska kunna minska vår energianvändning. Därför syftar studien i första hand på att beskriva hur varmvatten används. Under 2008 sker ytterligare mätningar i ca 60 hushåll. Resultatet av de mätningarna kommer också att publiceras i en rapport.

Format: A4
Identifierare ER2008:14
Utgivningsår 2008
Lagersaldo: 370
Pris: 150,00 kr
Artikel nr 2027
Ladda ner

Mätning av kall- och varmvattenanvändning i 44 hushåll

Delrapport i Energimyndighetens projekt.

Förbättrad energistatistik i bebyggelsen och industrin. I denna rapport presenteras resultaten från mätningar av varm- och kallvattenanvändning i 44 hushåll, varav 35 småhus och 9 lägenheter.
Målsättningen med projektet har varit att öka kunskapen om hur tappvatten används i svenska hushåll. Studien syftar i första hand till att beskriva hur mycket varmvatten som används eftersom det övergripande syftet är att få kunskap om hur stor del av hushållens energianvändning som används för uppvärmning av vatten.
Projektet ingår i Energimyndighetens arbete med att förbättra statistik- och kunskapsunderlaget om energianvändning i bebyggelsen. Arbetet bedrivs inom projektet Förbättrad energi¬statistik i bebyggelsen och industrin.

Format: A4
Identifierare ER2009:26
Utgivningsår 2009
Lagersaldo: 124
Pris: 150,00 kr
Artikel nr 2124
Ladda ner

Möjligheter att reducera koldioxidutsläpp

Enligt EG:s direktiv för handel med utsläppsrätter måste minst 90 % av den sammanlagda mängden utsläppsrätter delas ut gratis under perioden 2008-2012. Tilldelningsreglerna har lagts fast genom kriterier i bilaga lll till handelsdirektivet. Kriterium nr 3 ”Möjligheterna att minska utsläpp” innebär att länderna i tilldelningen måste beakta skillnader i den tekniska potentialen att reducera utsläppen på total nivå mellan den handlande och icke-handlande sektorn.

I denna rapport redovisas en allmän beskrivning av åtgärdsmöjligheter i energiproduktionssektorn samt en beräknad genomsnittskostnad för ett antal åtgärder. I rapporten konstateras bl.a. att utsläppen i energisektorn under ett normal år framför allt sker i anläggningar anslutna till fjärrvärmenäten, att utsläppen delvis är beroende av yttre omständigheter, att utsläppen relativt sett i Sverige är små men ändå betydelsefulla samt att det finns tekniska och ekonomiska möjligheter att reducera utsläppen.

Format: A4
Identifierare ER2006:17
Utgivningsår 2006
Lagersaldo: 33
Pris: 150,00 kr
Artikel nr 1801
Ladda ner

Naturgas i ekonomins och i politikens tjänst

En del av Energimyndighetens omvärldsanalys

I Sverige är ett av de länder i Europa där naturgasen spelar minst roll. Rapporten tar upp och besvarar frågan varför Sverige, till skillnad från övriga Europa, aldrig fick ett utbyggt naturgasnät. Den tar också upp den historiska och framtida utvecklingen av naturgas i Europa. Rapporten är ett led i Energimyndighetens kontinuerliga omvärldsbevakning.

Format: A4
Identifierare ER2008:22
Utgivningsår 2008
Lagersaldo: 37
Pris: 150,00 kr
Artikel nr 2052
Ladda ner

Nulägesrapport inom samordningsuppdraget fossilfri transportsektor

Energimyndigheten har fått i uppdrag att samordna omställningen till en fossilfri transportsektor. Denna rapport är en delredovisning och omfattar en sammanställning av identifierade hinder och pågående aktiviteter inom området, samt en beskrivning av det fortsatta arbetet i uppdraget. En sammanställning av ”Öppet forum” ingår, där olika aktörer bidrog med synpunkter på hur de ser på omställningen. Uppdraget genomförs i samarbete med Boverket, Naturvårdsverket, Trafikanalys, Trafikverket och Transportstyrelsen.

Format: .
Identifierare ER 2016:25
Utgivningsår 2016
Lagersaldo: 13
Pris: 150,00 kr
Artikel nr 2783
Ladda ner

Nya kunskaper om klimatproblemet

Energimyndigheten och Naturvårdsverket har gemensamt lämnat ett underlag till utvärderingen av Sveriges klimatstrategi, kontrollstation 2004.;I uppdraget ingick att redovisa ny kunskap om klimatproblemet. Rapporten redovisar kortfattat kunskapsläget om klimatförändringen globalt och regionalt och pågående aktiviteter för anpassning till ett förändrat klimat. Pågående forskning i Sverige till stöd för åtgärder och anpassningsbehov redovisas. Rapporten tar även upp viktiga framtida forskningsbehov.

Format: A4
Identifierare ER23:2004
Utgivningsår 2004
Lagersaldo: 325
Pris: 150,00 kr
Artikel nr 1652
Ladda ner

Nätverk om olja och gas

Oljan har en avgörande betydelse för Sveriges energiförsörjning trots åratal av ansträngningar med alternativa energikällor för att värma miljön. Det är nödvändigt att oljans betydelse för viktiga samhällsfunktioner är känd och att värdefull kunskap om olja, gas och kol bevaras och utvecklas. Mot bakrund av detta fick ÅF under 2001 i uppdrag att bygga upp och administrera ett Nätverk om Olja och Gas med Energimyndigheten som uppdragsgivare.;Denna rapport redovisar de aktiviteter, i form av seminarier och referat inklusive en utvärdering, som genomfördes från 2001 till juni 2003.

Format: A4
Identifierare ER 22:2003
Utgivningsår 2003
Lagersaldo: 74
Pris: 150,00 kr
Artikel nr 1568
Ladda ner

Nätverket för vindbruks årsrapport för 2014

Nätverket för vindbruk har en bred verksamhet med ett trettiotal verksamma projekt varje år. I den här årsrapporten redovisar vi resultaten från de projekt och aktiviteter som skett inom nätverkets ramar under 2014. En stor del av nätverkets resurser har under 2014 gått till olika utbildningssatsningar. Nätverket har under året bland annat arbetat fram en nätbaserad för vindkraftshandläggare på länsstyrelser och kommuner. Nätverket har också anordnat över hundra seminarier och mötesplatser under året med syfte att diskutera aktuella frågor med de som är berörda av den pågående utbyggnaden av vindkraften i landet.
På många av årets seminarier har fokus legat på möjligheterna att skapa lokal nytta i samband med vindkraftsetableringar, men ljud från vindkraftverk har också varit en central fråga. Bägge dessa frågor ser nätverket som centrala för arbetet med att öka acceptansen och förankringen för en fortsatt vindkraftutbyggnad i landet.

Format: A4
Identifierare ER2015:08
Utgivningsår 2015
Lagersaldo: 13
Pris: 150,00 kr
Artikel nr 2663
Ladda ner

Oljans ändlighet - Ett rörligt mål!

I rapporten konstateras dels att tillgången till utvinnbar olja inte är gränssättande för den globala energianvändningen de närmaste decennierna, dels att kostnaderna för att utvinna denna olja fortfarande är låga. Men det konstateras även att säkerheten i nuvarande försörjning är ifrågasatt - särskilt på kort sikt. Slutsatsen är klimatfrågan ännu så länge, tillsammans med försörjningssäkerheten, är de huvudsakliga motiven för ett minskat oljeberoende.

Format: A4
Identifierare ER2006:21
Utgivningsår 2006
Lagersaldo: 6
Pris: 150,00 kr
Artikel nr 1806
Ladda ner

Plan för uppföljning och utvärdering av omställning av transportsektorn till fossilfrihet

Denna rapport är framtagen av Transportstyrelsen, Energimyndigheten, Naturvårdsverket, Boverket, Trafikanalys och Trafikverket och utgör underlag till den strategiska plan för omställning av transportsektorn (ER2017:07) som tagits fram inom omställningsuppdraget. I rapporten beskrivs en plan för uppföljning och utvärdering av transportsektorns omställning till fossilfrihet ska. Uppföljning och utvärdering är viktiga verktyg för att veta om och hur målet kan nås.

Format: -
Identifierare ER 2017:11
Utgivningsår 2017
Lagersaldo: 6
Pris: 150,00 kr
Artikel nr 2815
Ladda ner

Potentiell avsättning av biomassa för produktion av el, värme och drivmedel inklusive energikombinat End pdf

Det växande intresset för att använda biomassa i produktion av både värme, el och drivmedel leder till behov av att studera hur biomassan kommer att avsättas geografiskt och mängdmässigt. Denna rapport beskriver de tekniska och fysiska förutsättningarna för att öka användningen av biobränslen i Sverige inom en 10 till 20-års period. Samtidigt identifieras inom vilka regioner i Sverige en allt kraftigare efterfrågan av biobränsle kan bli verklighet, och därmed behov av en allt intensivare produktion av biobränslen från jord- och skogsbruk. Studien uppmärksammar användningen av biomassa för drivmedelsproduktion, liksom potentialen för nya kombinatlösningar där drivmedel produceras tillsammans med andra energibärare som el, värme och fasta biobränslen.

Format: A4
Identifierare ER2008:04
Utgivningsår 1900
Lagersaldo: 0
Pris: 150,00 kr
Artikel nr 2026
Ladda ner

Power Sector Reform in the Baltic States

Denna publikation är skriven på engelska och finns inte översatt till svenska

Statens Energimyndighet arbetar på olika sätt med att stödja en miljövänlig utveckling av energisektorn i Östersjöregionen. Myndigheten anser det vara av största vikt att utnyttja marknadskrafterna för att införa mera rationell användning av både produktionsresurser och nätanläggningar som på sikt leder till ett mera effektivt och miljövänligt elsystem i Baltikum. Energimyndigheten har vid tidigare tillfällen följt upp elmarkndens utveckling i Baltikum och undersökt fördelarna med en marknadsintegration i denna region (bl.a. Rapporten ""Future conditions for integration of the Baltic Electricity Supply System"", ER 25:1999).

I den föreliggande rapporten ""Power Sector Reform in the Baltic States"" framträder tydligt en del viktiga framsteg som skett i dessa länders elmarknadsintegration under de senaste åren samtidigt som den också visar på att en del viktiga moment i elmarknadsreformen återstår. Den sätter också fokus på vilka områden som kan behöva studeras närmare eller utökas för att inkludera flera länder i Östersjöregionen. Rapporten avses utgöra ett underlag även när det gäller att bedöma behoven att ersätta den elproduktion som försvinner i och med att de båda kärnkraftreaktorerna i Ignalina i Litauen stängs. Vilka är i så fall möjligheterna till användning av alternativa energislag som inte ökar utsläppen av växthusgaser? Vilka möjligheter finns att genomföra sådana projekt som klimatprojekt i enlighet med Kyotoprotokollets mekanism för Gemensamt Genomförande (Joint Implementation)? Rapporten berör även sådana aspekter.

Format: A4
Identifierare ER 15:2002
Utgivningsår 2002
Lagersaldo: 82
Pris: 150,00 kr
Artikel nr 1482
Ladda ner

Praktiskt genomförande av gemensamma projekt för havsbaserad vindkraft

En delrapport i uppdraget om samarbetsmekanismer i Energimyndighetens regleringsbrev 2013

I regleringsbrevet för 2013 har Energimyndigheten fått i uppdrag att bidra till fortsatt analys och praktiska förberedelser för ett eventuellt samarbete med andra medlemsländer. Den här rapporten utgör Energimyndighetens redovisning av den del av uppdraget som rör samarbete genom gemensamma projekt. Delredovisningen omfattar att i samråd med branschen ta fram ett förslag på praktisk hantering för genomförande av eventuella gemensamma projekt för havsbaserad vindkraft. Syftet med uppdraget är att skapa ökad tydlighet och underlätta ett eventuellt genomförande av gemensamma projekt.

Format: A4
Identifierare ER2013:26
Utgivningsår 2013
Lagersaldo: 32
Pris: 150,00 kr
Artikel nr 2562
Ladda ner
Visar 226 - 250 av 420